ATF4 anticorps

N° du produit ABIN5693161

Détail du produit anti-ATF4 anticorps

Antigène: ATF4 (Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATF4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marque: Picoband™

Séquence: KELEKKNEAL KERADSLAKE IQYLKDLIEE VRKARGKKRV P

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for ATF4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human ATF4 (KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-ATF4 (ABIN5693161)

Hu, Li, Li: "MARVELD1 Inhibits Nonsense-Mediated RNA Decay by Repressing Serine Phosphorylation of UPF1." dans: PLoS ONE, Vol. 8, Issue 6, pp. e68291, (2013) (PubMed).

Détails sur ATF4

Antigène: ATF4 (Activating Transcription Factor 4 (Tax-Responsive Enhancer Element B67) (ATF4))

Autre désignation: ATF4 (ATF4 Produits)

Synonymes: anticorps CREB-2, anticorps CREB2, anticorps TAXREB67, anticorps TXREB, anticorps ATF4, anticorps atf-4, anticorps creb-2, anticorps creb2, anticorps taxreb67, anticorps txreb, anticorps atf4, anticorps wu:fj01c08, anticorps wu:fk30b04, anticorps zgc:85951, anticorps sb:eu681, anticorps wu:fb08f07, anticorps zgc:171702, anticorps Atf-4, anticorps C/ATF, anticorps ATF4-I, anticorps atf4-a, anticorps atf4-b, anticorps atf4-ii, anticorps activating transcription factor 4, anticorps activating transcription factor 4 L homeolog, anticorps activating transcription factor 4a, anticorps activating transcription factor 4b, anticorps activating transcription factor 4 S homeolog, anticorps ATF4, anticorps atf4, anticorps Atf4, anticorps atf4.L, anticorps atf4a, anticorps atf4b, anticorps atf4.S

Sujet:

Synonyms: Cyclic AMP-dependent transcription factor ATF-4, cAMP-dependent transcription factor ATF-4, Activating transcription factor 4, Cyclic AMP-responsive element-binding protein 2, CREB-2, cAMP-responsive element-binding protein 2, DNA-binding protein TAXREB67, Tax-responsive enhancer element-binding protein 67, TaxREB67, ATF4, CREB2, TXREB

Background: ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.

UniProt: P18848

Pathways: Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Unfolded Protein Response