Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

FZD4 anticorps

FZD4 Reactivité: Humain, Souris, Rat WB, IHC Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN5693200
  • Antigène Voir toutes FZD4 Anticorps
    FZD4 (Frizzled Family Receptor 4 (FZD4))
    Reactivité
    • 69
    • 55
    • 18
    • 9
    • 8
    • 8
    • 7
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 1
    • 1
    Humain, Souris, Rat
    Hôte
    • 74
    • 7
    • 5
    • 3
    Lapin
    Clonalité
    • 80
    • 9
    Polyclonal
    Conjugué
    • 36
    • 7
    • 6
    • 6
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Cet anticorp FZD4 est non-conjugé
    Application
    • 67
    • 33
    • 25
    • 13
    • 13
    • 7
    • 7
    • 5
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB), Immunohistochemistry (IHC)
    Marque
    Picoband™
    Séquence
    QNLGYNVTKM PNLVGHELQT DAELQLTTFT PLIQY
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Frizzled 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
    Immunogène
    A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY).
    Top Product
    Discover our top product FZD4 Anticorps primaire
  • Indications d'application

    Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

    Application Details: Western blot, 0.1-0.5 μg/mL
    Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Buffer
    Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
  • Bychkov, Kirichenko, Shulepko, Mikhaylova, Kirpichnikov, Lyukmanova: "Mambalgin-2 Inhibits Growth, Migration, and Invasion of Metastatic Melanoma Cells by Targeting the Channels Containing an ASIC1a Subunit Whose Up-Regulation Correlates with Poor Survival Prognosis." dans: Biomedicines, Vol. 9, Issue 10, (2021) (PubMed).

  • Antigène
    FZD4 (Frizzled Family Receptor 4 (FZD4))
    Autre désignation
    FZD4 (FZD4 Produits)
    Synonymes
    anticorps CG4626, anticorps DFz4, anticorps Dfz4, anticorps Dm Fz4, anticorps Dmel\\CG4626, anticorps Fz4, anticorps anon-WO0170980.10, anticorps anon-WO0170980.11, anticorps fz1, anticorps zg01, anticorps CD344, anticorps EVR1, anticorps FEVR, anticorps FZD4S, anticorps Fz-4, anticorps FzE4, anticorps GPCR, anticorps hFz4, anticorps frizzled4, anticorps fz4, anticorps FZ-4, anticorps frizzled 4, anticorps frizzled class receptor 4, anticorps frizzled-4, anticorps frizzled class receptor 4 S homeolog, anticorps fz4, anticorps fzd4, anticorps Tsp_10376, anticorps FZD4, anticorps Fzd4, anticorps fzd4.S
    Sujet

    Synonyms: Frizzled-4, Fz-4, hFz4, FzE4, CD344, FZD4

    Tissue Specificity: Almost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and liver.

    Background: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

    Pathways
    Signalisation WNT, Hormone Transport, Sensory Perception of Sound
Vous êtes ici:
Support technique