FZD4 anticorps
-
- Antigène Voir toutes FZD4 Anticorps
- FZD4 (Frizzled Family Receptor 4 (FZD4))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FZD4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Marque
- Picoband™
- Séquence
- QNLGYNVTKM PNLVGHELQT DAELQLTTFT PLIQY
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for Frizzled 4 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY).
- Top Product
- Discover our top product FZD4 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
-
Mambalgin-2 Inhibits Growth, Migration, and Invasion of Metastatic Melanoma Cells by Targeting the Channels Containing an ASIC1a Subunit Whose Up-Regulation Correlates with Poor Survival Prognosis." dans: Biomedicines, Vol. 9, Issue 10, (2021) (PubMed).
: "
-
Mambalgin-2 Inhibits Growth, Migration, and Invasion of Metastatic Melanoma Cells by Targeting the Channels Containing an ASIC1a Subunit Whose Up-Regulation Correlates with Poor Survival Prognosis." dans: Biomedicines, Vol. 9, Issue 10, (2021) (PubMed).
-
- Antigène
- FZD4 (Frizzled Family Receptor 4 (FZD4))
- Autre désignation
- FZD4 (FZD4 Produits)
- Synonymes
- anticorps CG4626, anticorps DFz4, anticorps Dfz4, anticorps Dm Fz4, anticorps Dmel\\CG4626, anticorps Fz4, anticorps anon-WO0170980.10, anticorps anon-WO0170980.11, anticorps fz1, anticorps zg01, anticorps CD344, anticorps EVR1, anticorps FEVR, anticorps FZD4S, anticorps Fz-4, anticorps FzE4, anticorps GPCR, anticorps hFz4, anticorps frizzled4, anticorps fz4, anticorps FZ-4, anticorps frizzled 4, anticorps frizzled class receptor 4, anticorps frizzled-4, anticorps frizzled class receptor 4 S homeolog, anticorps fz4, anticorps fzd4, anticorps Tsp_10376, anticorps FZD4, anticorps Fzd4, anticorps fzd4.S
- Sujet
-
Synonyms: Frizzled-4, Fz-4, hFz4, FzE4, CD344, FZD4
Tissue Specificity: Almost ubiquitous. Largely expressed in adult heart, skeletal muscle, ovary, and fetal kidney. Moderate amounts in adult liver, kidney, pancreas, spleen, and fetal lung, and small amounts in placenta, adult lung, prostate, testis, colon, fetal brain and liver.
Background: Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
- Pathways
- Signalisation WNT, Hormone Transport, Sensory Perception of Sound
-