FZD3 anticorps

N° du produit ABIN5693226

Détail du produit anti-FZD3 anticorps

Antigène: FZD3 (Frizzled Family Receptor 3 (FZD3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZD3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Séquence: MPNLLNHYDQ QTAALAMEPF HPMVNLDCSR DFRPFL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for FZD3 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human FZD3 (MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur FZD3

Antigène: FZD3 (Frizzled Family Receptor 3 (FZD3))

Autre désignation: FZD3 (FZD3 Produits)

Synonymes: anticorps Fz-3, anticorps FZ-3, anticorps fz3, anticorps Xfz3, anticorps frz3, anticorps hfz3, anticorps frz-3, anticorps frizzled3, anticorps frizzled-3, anticorps FZD3, anticorps AU020229, anticorps D930050A07Rik, anticorps Fz3, anticorps fz9, anticorps fzd3, anticorps zg09, anticorps fzd3l, anticorps frizzled class receptor 3, anticorps frizzled class receptor 3 L homeolog, anticorps frizzled class receptor 3a, anticorps frizzled class receptor 3b, anticorps FZD3, anticorps fzd3, anticorps fzd3.L, anticorps Fzd3, anticorps fzd3a, anticorps fzd3b

Sujet:

Synonyms: Frizzled-3, Fz-3, hFz3, FZD3

Tissue Specificity: Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.

Background: Frizzled-3 is a protein that in humans is encoded by the FZD3 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia.

Pathways: Signalisation WNT, Tube Formation