LMO2 anticorps

N° du produit ABIN5693241

Détail du produit anti-LMO2 anticorps

Antigène: LMO2 (LIM Domain Only 2 (Rhombotin-Like 1) (LMO2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LMO2 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: QKHFCVGDRY LLINSDIVCE QDIYEWTKIN GMI

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for LMO2 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human LMO2 (QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot,0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur LMO2

Antigène: LMO2 (LIM Domain Only 2 (Rhombotin-Like 1) (LMO2))

Autre désignation: LMO2 (LMO2 Produits)

Synonymes: anticorps Rbtn-2, anticorps Rbtn2, anticorps Rhom-2, anticorps Ttg2, anticorps RBTN2, anticorps RBTNL1, anticorps RHOM2, anticorps TTG2, anticorps wu:fc83a08, anticorps zgc:111930, anticorps LMO-2, anticorps lmo2-A, anticorps xlmo2, anticorps rhombotin-2, anticorps LIM domain only 2, anticorps LIM domain only 2 (rhombotin-like 1), anticorps LIM domain only 2 S homeolog, anticorps lmo2, anticorps LMO2, anticorps Lmo2, anticorps lmo2.S

Sujet:

Synonyms: Rhombotin-2, Cysteine-rich protein TTG-2, LIM domain only protein 2, LMO-2, T-cell translocation protein 2, LMO2, RBTN2, RBTNL1, RHOM2, TTG2

Background: LIM domain only 2 (rhombotin-like 1), also known as LMO2, RBTNL1, RBTN2, RHOM2, LIM Domain Only Protein 2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.

UniProt: P25791

Pathways: Chromatin Binding