C4A anticorps (Complement Fragment C4a)

Details for Product anti-C4a Antibody No. ABIN5693263, Fournisseur: Connectez-vous pour afficher
  • C4
  • C4A2
  • C4A3
  • C4A4
  • C4A6
  • C4AD
  • C4S
  • CO4
  • CPAMD2
  • RG
  • Slp
  • C4-1
  • C4b
  • complement C4A (Rodgers blood group)
  • complement component 4A (Rodgers blood group)
  • C4A
  • C4a
Humain, Souris, Rat (Rattus)
Cet anticorp C4A est non-conjugé
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Marque Picoband™
Immunogène A synthetic peptide corresponding to a sequence of human C4A (YMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQ).
Réactivité croisée (Details) No cross reactivity with other proteins.
Attributs du produit Rabbit IgG polyclonal antibody for C4A detection. Tested with WB in Human,Mouse,Rat.
Plasmids, Primers & others Plasmids, Primers & others C4A products on genomics-online (e.g. as negative or positive controls)
Autre désignation C4A (C4a Antibody Extrait)

Synonyms: Complement C4-A, Acidic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, Complement C4 beta chain, Complement C4-A alpha chain, C4a anaphylatoxin, C4b-A, C4d-A, Complement C4 gamma chain, C4A, CO4, CPAMD2

Tissue Specificity: Complement component C4 is expressed at highest levels in the liver, at moderate levels in the adrenal cortex, adrenal medulla, thyroid gland,and the kidney, and at lowest levels in the heart, ovary, small intestine, thymus, pancreas and spleen. The extra-hepatic sites of expression may be important for the local protection and inflammatory response.

Background: Complement C4-A is a protein that in humans is encoded by the C4A gene. This gene encodes the acidic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus and type I diabetes mellitus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. Two transcript variants encoding different isoforms have been found for this gene.

UniProt P0C0L4
Pathways Système du Complément
Indications d'application

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5&mu,g/mL

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Buffer Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
Images (Fournisseur)
Western Blotting (WB) image for anti-Complement Fragment 4a (C4A) antibody (ABIN5693263) Western blot analysis of C4A using anti-C4A antibody . Electrophoresis was performed...
Produit citée dans: Liang, Zhang, Wang: "Alternative complement activity in the egg cytosol of amphioxus Branchiostoma belcheri: evidence for the defense role of maternal complement components." dans: PLoS ONE, Vol. 4, Issue 1, pp. e4234, 2009 (PubMed).

Wang, Zhang, Wang, An: "Complement activity in the egg cytosol of zebrafish Danio rerio: evidence for the defense role of maternal complement components." dans: PLoS ONE, Vol. 3, Issue 1, pp. e1463, 2008 (PubMed).

Avez-vous cherché autre chose?