Regucalcin anticorps

N° du produit ABIN5708276

Détail du produit anti-Regucalcin anticorps

Antigène: Regucalcin (RGN)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Regucalcin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids YSVDAFDYDLQTGQISNRRSVYKLEKEEQIPD were used as the immunogen for the Regucalcin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Regucalcin antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Regucalcin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Regucalcin

Antigène: Regucalcin (RGN)

Autre désignation: Regucalcin (RGN Produits)

Synonymes: anticorps CG1803, anticorps Dmel\\CG1803, anticorps Regucalcin, anticorps T1, anticorps GNL, anticorps zgc:92078, anticorps smp30, anticorps xsmp-30, anticorps xsmp30, anticorps DyakGE16489, anticorps dyak_GLEANR_17905, anticorps GE16489, anticorps regucalcin, anticorps SMP30, anticorps AI265316, anticorps RC, anticorps rgn-A, anticorps Rc, anticorps Reguc, anticorps SMP-30, anticorps CG1803 gene product from transcript CG1803-RA, anticorps regucalcin, anticorps GE16489 gene product from transcript GE16489-RB, anticorps regucalcin (senescence marker protein-30), anticorps regucalcin L homeolog, anticorps regucalcin, anticorps rgn, anticorps LOC465598, anticorps RGN, anticorps Dyak\regucalcin, anticorps Rgn, anticorps rgn.L

Sujet: Regucalcin is a protein that in humans is encoded by the RGN gene. The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23.

UniProt: Q15493