INPP5D anticorps

N° du produit ABIN5708392

Détail du produit anti-INPP5D anticorps

Antigène: INPP5D (Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp INPP5D est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ from the human protein were used as the immunogen for the SHIP1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SHIP1 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the SHIP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur INPP5D

Antigène: INPP5D (Inositol Polyphosphate-5-Phosphatase, 145kDa (INPP5D))

Autre désignation: SHIP1 (INPP5D Produits)

Synonymes: anticorps INPP5D, anticorps 256.t00004, anticorps 13.t00027, anticorps ship, anticorps ship1, anticorps AI323613, anticorps SHIP, anticorps SHIP-1, anticorps SHIP1, anticorps s-SHIP, anticorps SIP-145, anticorps hp51CN, anticorps inositol polyphosphate-5-phosphatase D, anticorps phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1, anticorps inositol polyphosphate 5-phosphatase, anticorps inositol polyphosphate-5-phosphatase D L homeolog, anticorps INPP5D, anticorps LOC100446045, anticorps inpp5d, anticorps EHI_159880, anticorps EHI_153490, anticorps inpp5d.L, anticorps LOC100380693, anticorps Inpp5d

Sujet: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, also called Inositol polyphosphate-5-phosphatase of 145 kDa, SIP-145 and SH2 domain-containing inositol phosphatase 1 (SHIP1), is an enzyme that in humans is encoded by the INPP5D gene. This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. The protein is also partly localized to the nucleus, where it may be involved in nuclear inositol phosphate signaling processes. Overall, the protein functions as a negative regulator of myeloid cell proliferation and survival. Mutations in this gene are associated with defects and cancers of the immune system.

UniProt: Q92835

Pathways: TCR Signaling, BCR Signaling, L'effet Warburg