Tel:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@anticorps-enligne.fr

METTL12 anticorps (Methyltransferase Like 12) Primary Antibody

METTL12 Reactivité: Humain IHC (p) Hôte: Lapin Polyclonal
N° du produit ABIN5774575
$577.33
Plus shipping costs $45.00
100 μL
local_shipping Destination: Etats-Unis
Envoi sous 11 à 12 jours ouvrables
  • Antigène
    Reactivité
    Humain
    Hôte
    Lapin
    Clonalité
    Polyclonal
    Application
    Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Fonction
    Rabbit polyclonal antibody raised against partial recombinant human LOC751071.
     Réactivité croisée
    Humain
    Immunogène

    immunogen: Recombinant protein corresponding to human LOC751071.

    Immunogen Sequence: GTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAY

    Isotype
    IgG
  • Indications d'application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
    The optimal working dilution should be determined by the end user.
    Restrictions
    For Research Use only
  • Format
    Liquid
    Buffer
    In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.
    Stock
    4 °C,-20 °C
    Stockage commentaire
    Store at 4°C for short term storage. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Antigène
    Autre désignation
    LOC751071 (METTL12 Antibody Extrait)
    Synonymes
    U99HG, mettl12, methyltransferase like 12, zgc:113305, METTL12, zgc:113305
    Sujet
    Full Gene Name: methyltransferase LOC751071, mitochondrial-like
    ID gène
    751071
    UniProt
    A8MUP2
Vous êtes ici: