Arginyl Aminopeptidase (Aminopeptidase B) (RNPEP) anticorps

N° du produit ABIN5774692

Détail du produit

Antigène:

Arginyl Aminopeptidase (Aminopeptidase B) (RNPEP)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)

Fonction: Rabbit polyclonal antibody raised against partial recombinant human RNPEP

Réactivité croisée: Humain

Immunogène:

immunogen: Recombinant protein corresponding to human RNPEP.

Immunogen Sequence: QALCVSFPQPCRAAERLQVLLTYRVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWEKRGPNKFF

Isotype: IgG

Information d'application

Indications d'application: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE, which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.

Détail du antigène

Antigène:

Arginyl Aminopeptidase (Aminopeptidase B) (RNPEP)

Autre désignation: RNPEP (RNPEP Antibody Extrait)

Synonymes: MGC69297, zgc:100971, MGC82089, arginyl aminopeptidase (aminopeptidase B), arginyl aminopeptidase, arginyl aminopeptidase (aminopeptidase B) L homeolog, rnpep, RNPEP, rnpep.L, Rnpep

Sujet: Full Gene Name: arginyl aminopeptidase (aminopeptidase B)
Synonyms: DKFZp547H084

ID gène: 6051

UniProt: Q9H4A4