NR5A1 anticorps (Middle Region)

N° du produit ABIN629578

Détail du produit anti-NR5A1 anticorps

Antigène: NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR5A1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR5 A1 antibody was raised against the middle region of NR5 1

Purification: Purified

Immunogène: NR5 A1 antibody was raised using the middle region of NR5 1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR5A1 Blocking Peptide, catalog no. 33R-5322, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR5A1

Antigène: NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))

Autre désignation: NR5A1 (NR5A1 Produits)

Synonymes: anticorps AD4BP, anticorps ELP, anticorps FTZ1, anticorps FTZF1, anticorps POF7, anticorps SF-1, anticorps SF1, anticorps SPGF8, anticorps SRXY3, anticorps Ad4BP, anticorps ELP-3, anticorps Ftz-F1, anticorps Ftzf1, anticorps Ad4BP/SF-1, anticorps Ad4bp, anticorps Sf-1, anticorps NR5A1, anticorps sf-1, anticorps elp, anticorps sf1, anticorps ftz1, anticorps ad4bp, anticorps ftzf1, anticorps SF-1/Ad4BP, anticorps SI:zC167P9.2, anticorps ff1d, anticorps nr5a2l, anticorps nuclear receptor subfamily 5 group A member 1, anticorps nuclear receptor subfamily 5, group A, member 1, anticorps nuclear receptor subfamily 5 group A member 1 L homeolog, anticorps nuclear receptor subfamily 6 group A member 1, anticorps nuclear receptor subfamily 5, group A, member 1b, anticorps NR5A1, anticorps Nr5a1, anticorps nr5a1.L, anticorps nr5a1, anticorps NR6A1, anticorps nr5a1b

Sujet: NR5A1 is an important regulator of steroidogeneis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Maintenance of Protein Location