MBD2 anticorps (Middle Region)

N° du produit ABIN629604

Détail du produit anti-MBD2 anticorps

Antigène: MBD2 (Methyl-CpG Binding Domain Protein 2 (MBD2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MBD2 antibody was raised against the middle region of MBD2

Purification: Purified

Immunogène: MBD2 antibody was raised using the middle region of MBD2 corresponding to a region with amino acids DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT

Information d'application

Indications d'application: WB: 0.625 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MBD2 Blocking Peptide, catalog no. 33R-1873, is also available for use as a blocking control in assays to test for specificity of this MBD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBD2

Antigène: MBD2 (Methyl-CpG Binding Domain Protein 2 (MBD2))

Autre désignation: MBD2 (MBD2 Produits)

Synonymes: anticorps MBD2, anticorps DMTase, anticorps NY-CO-41, anticorps MBD2a, anticorps wu:fa97f06, anticorps zgc:111862, anticorps methyl-CpG binding domain protein 2, anticorps methyl-CpG binding domain protein 2 S homeolog, anticorps MBD2, anticorps Mbd2, anticorps mbd2, anticorps mbd2.S

Sujet: MBD2 belongs to a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD2 can also repress transcription from methylated gene promoters. MBD2 may function as a mediator of the biological consequences of the methylation signal. It is also reported that the MBD2 functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Chromatin Binding