ATP5B anticorps (N-Term)

N° du produit ABIN629672

Détail du produit anti-ATP5B anticorps

Antigène: ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP5B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ATP5 B antibody was raised against the N terminal of ATP5

Purification: Purified

Immunogène: ATP5 B antibody was raised using the N terminal of ATP5 corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP5B Blocking Peptide, catalog no. 33R-7154, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP5B

Antigène: ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))

Autre désignation: ATP5B (ATP5B Produits)

Synonymes: anticorps atpmb, anticorps atpsb, anticorps Atpsyn-beta, anticorps hm:zehn0534, anticorps im:6793121, anticorps wu:fj38d01, anticorps zgc:111961, anticorps ATPMB, anticorps ATPSB, anticorps ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, anticorps ATP synthase subunit beta, mitochondrial, anticorps ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit, anticorps ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog, anticorps ATP5B, anticorps atp5b, anticorps Atp5b, anticorps LOC100401662, anticorps LOC100635763, anticorps atp5b.S

Sujet: ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process