GLS2 anticorps
-
- Antigène Voir toutes GLS2 Anticorps
- GLS2 (Glutaminase 2 (Liver, Mitochondrial) (GLS2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLS2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
- Top Product
- Discover our top product GLS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLS2 Blocking Peptide, catalog no. 33R-3113, is also available for use as a blocking control in assays to test for specificity of this GLS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLS2 (Glutaminase 2 (Liver, Mitochondrial) (GLS2))
- Autre désignation
- GLS2 (GLS2 Produits)
- Synonymes
- anticorps si:ch211-216k22.10, anticorps GA, anticorps GLS, anticorps LGA, anticorps hLGA, anticorps A330074B06Rik, anticorps AI195532, anticorps Lga, anticorps Ga, anticorps glutaminase 2, anticorps glutaminase 2a (liver, mitochondrial), anticorps glutaminase 2 (liver, mitochondrial), anticorps glsA2, anticorps LOAG_03311, anticorps gls2a, anticorps GLS2, anticorps Gls2
- Sujet
- GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport, L'effet Warburg
-