CPS1 anticorps (Middle Region)
-
- Antigène Voir toutes CPS1 Anticorps
- CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPS1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- CPS1 antibody was raised against the middle region of CPS1
- Purification
- Purified
- Immunogène
- CPS1 antibody was raised using the middle region of CPS1 corresponding to a region with amino acids YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI
- Top Product
- Discover our top product CPS1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CPS1 Blocking Peptide, catalog no. 33R-10208, is also available for use as a blocking control in assays to test for specificity of this CPS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPS1 (Carbamoyl-Phosphate Synthase 1, Mitochondrial (CPS1))
- Autre désignation
- CPS1 (CPS1 Produits)
- Synonymes
- anticorps CPSASE1, anticorps cps, anticorps 4732433M03Rik, anticorps CPS, anticorps D1Ucla3, anticorps Cps1, anticorps carbamoyl-phosphate synthase 1, anticorps carbamoyl-phosphate synthase 1 L homeolog, anticorps carbamoyl-phosphate synthetase 1, anticorps peptidase M20 domain containing 1, anticorps CPS1, anticorps Cps1, anticorps cps1.L, anticorps cps1, anticorps PM20D1
- Sujet
- Carbamoyl phosphate synthetase I is the rate-limiting enzyme that catalyzes the first committed step of the hepatic urea cycle. The mitochondrial isozyme is designated CPS I and the cytoplasmic enzyme CPS II. CPS II is part of a multifunctional enzyme, called the CAD trifunctional protein of pyrimidine biosynthesis.
- Poids moléculaire
- 165 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Cellular Glucan Metabolic Process
-