NDUFV1 anticorps

N° du produit ABIN629687

Détail du produit anti-NDUFV1 anticorps

Antigène: NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDUFV1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: NDUFV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDUFV1 Blocking Peptide, catalog no. 33R-2999, is also available for use as a blocking control in assays to test for specificity of this NDUFV1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDUFV1

Antigène: NDUFV1 (NADH Dehydrogenase (Ubiquinone) Flavoprotein 1, 51kDa (NDUFV1))

Autre désignation: NDUFV1 (NDUFV1 Produits)

Synonymes: anticorps GB17095, anticorps uqor1, anticorps DDBDRAFT_0188174, anticorps DDBDRAFT_0191420, anticorps DDB_0188174, anticorps DDB_0191420, anticorps wu:fc01f01, anticorps wu:fc12f12, anticorps zgc:86620, anticorps CI-51kD, anticorps CI-51K, anticorps CI51KD, anticorps UQOR1, anticorps NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial, anticorps NADH:ubiquinone oxidoreductase core subunit V1, anticorps NADH dehydrogenase ubiquinone flavoprotein 1, anticorps NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa, anticorps NADH dehydrogenase (ubiquinone) flavoprotein 1, anticorps NADH:ubiquinone oxidoreductase core subunit V1 L homeolog, anticorps LOC408367, anticorps NDUFV1, anticorps ndufv1, anticorps Ndufv1, anticorps LOC100179486, anticorps ndufv1.L

Sujet: The NDUFV1 gene encodes the 51 kDa subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.

Poids moléculaire: 51 kDa (MW of target protein)