CEACAM6 anticorps
-
- Antigène Voir toutes CEACAM6 Anticorps
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CEACAM6 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
- Top Product
- Discover our top product CEACAM6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CEACAM6 Blocking Peptide, catalog no. 33R-2483, is also available for use as a blocking control in assays to test for specificity of this CEACAM6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEACAM6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CEACAM6 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 6 (CEACAM6))
- Autre désignation
- CEACAM6 (CEACAM6 Produits)
- Synonymes
- anticorps CD66c, anticorps CEAL, anticorps NCA, anticorps carcinoembryonic antigen-related cell adhesion molecule 6, anticorps carcinoembryonic antigen related cell adhesion molecule 6, anticorps Ceacam6, anticorps CEACAM6
- Sujet
- Many breast, pancreatic, colonic and non-small-cell lung carcinoma lines express CEACAM6 and CEACAM5, and antibodies to both can affect tumor cell growth in vitro and in vivo. CEACAM6 expression is elevated in many solid tumors, but variable as a function of histotype. It may be a promising target for antibody-based therapy.
- Poids moléculaire
- 38 kDa (MW of target protein)
-