TNNT3 anticorps
-
- Antigène Voir toutes TNNT3 Anticorps
- TNNT3 (Fast Skeletal Troponin T (TNNT3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNNT3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE
- Top Product
- Discover our top product TNNT3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Troponin T Type 3 Blocking Peptide, catalog no. 33R-7331, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNNT3 (Fast Skeletal Troponin T (TNNT3))
- Autre désignation
- Troponin T Type 3 (TNNT3 Produits)
- Synonymes
- anticorps fTnT, anticorps tnnt3a, anticorps TNTF, anticorps TnTf, anticorps Tnt, anticorps Tnnt3, anticorps troponin T3, fast skeletal type, anticorps troponin T3, skeletal, fast, anticorps troponin T3, fast skeletal type S homeolog, anticorps troponin T type 3 (skeletal, fast), anticorps troponin T1, slow skeletal type, anticorps TNNT3, anticorps Tnnt3, anticorps tnnt3.S, anticorps TNNT1
- Sujet
- Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
- Poids moléculaire
- 30 kDa (MW of target protein)
-