SRSF1 anticorps
-
- Antigène Voir toutes SRSF1 Anticorps
- SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))
-
Reactivité
- Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRSF1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SFRS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS
- Top Product
- Discover our top product SRSF1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS1 Blocking Peptide, catalog no. 33R-3658, is also available for use as a blocking control in assays to test for specificity of this SFRS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRSF1 (serine/arginine-Rich Splicing Factor 1 (SRSF1))
- Autre désignation
- SFRS1 (SRSF1 Produits)
- Synonymes
- anticorps ASF, anticorps SF2, anticorps SF2p33, anticorps SFRS1, anticorps SRp30a, anticorps 1110054N12Rik, anticorps 5730507C05Rik, anticorps 6330415C05Rik, anticorps AI482334, anticorps AW491331, anticorps Asf, anticorps Sf2, anticorps Sfrs1, anticorps DKFZp469K2419, anticorps sfrs1, anticorps sfrs1b, anticorps wu:fb80g05, anticorps zgc:111894, anticorps zgc:65898, anticorps zgc:76897, anticorps asf, anticorps sf2, anticorps sf2p33, anticorps srp30a, anticorps sfrs1a, anticorps sfrs1l, anticorps wu:fb52g10, anticorps wu:fb97g12, anticorps zgc:66146, anticorps serine and arginine rich splicing factor 1, anticorps serine/arginine-rich splicing factor 1, anticorps serine/arginine-rich splicing factor 1b, anticorps serine/arginine-rich splicing factor 1 L homeolog, anticorps serine/arginine-rich splicing factor 1a, anticorps SRSF1, anticorps Srsf1, anticorps srsf1b, anticorps srsf1.L, anticorps srsf1a
- Sujet
- SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-