PSMA1 anticorps

N° du produit ABIN629944

Détail du produit anti-PSMA1 anticorps

Antigène: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PSMA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSMA1 Blocking Peptide, catalog no. 33R-6001, is also available for use as a blocking control in assays to test for specificity of this PSMA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSMA1

Antigène: PSMA1 (Proteasome Subunit alpha Type 1 (PSMA1))

Autre désignation: PSMA1 (PSMA1 Produits)

Sujet: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA