SFPQ anticorps

N° du produit ABIN629946

Détail du produit anti-SFPQ anticorps

Antigène: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFPQ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFPQ Blocking Peptide, catalog no. 33R-7413, is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFPQ

Antigène: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Autre désignation: SFPQ (SFPQ Produits)

Synonymes: anticorps 1110004P21Rik, anticorps 2810416M14Rik, anticorps 5730453G22Rik, anticorps 9030402K04Rik, anticorps AU021830, anticorps D4Ertd314e, anticorps Gm12940, anticorps OTTMUSG00000009329, anticorps PSF, anticorps REP1, anticorps hm:zeh0027, anticorps wu:fa11h12, anticorps wu:fd10f03, anticorps zgc:85935, anticorps POMP100, anticorps splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated), anticorps splicing factor proline/glutamine-rich, anticorps splicing factor proline and glutamine rich, anticorps Sfpq, anticorps sfpq, anticorps SFPQ

Sujet: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.

Poids moléculaire: 78 kDa (MW of target protein)