LSM2 anticorps

N° du produit ABIN630011

Détail du produit anti-LSM2 anticorps

Antigène: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSM2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSM2 Blocking Peptide, catalog no. 33R-9016, is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSM2

Antigène: LSM2 (LSM2 Homolog, U6 Small Nuclear RNA Associated (LSM2))

Autre désignation: LSM2 (LSM2 Produits)

Synonymes: anticorps LSM2, anticorps 61.t00040, anticorps 18.m06211, anticorps 18.m06235, anticorps lsm2, anticorps C6orf28, anticorps G7B, anticorps YBL026W, anticorps snRNP, anticorps D17H6S56E-2, anticorps D17H6S56E2, anticorps Dmapl, anticorps Dmpkap, anticorps G7b, anticorps Sm-X5, anticorps SmX5, anticorps wu:fe48h10, anticorps zgc:101795, anticorps LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated, anticorps U6 snRNA-associated sm-like protein Lsm2, putative, anticorps u6 snRNA-associated sm-like protein lsm2, anticorps U6 snRNA-associated Sm-like protein LSm2, anticorps U6 snRNA-associated Sm-like protein LSm2, putative, anticorps u6 snRNA-associated sm-like protein Lsm2, anticorps U6 snRNA-associated sm-like protein Lsm2,putative, anticorps u6 snRNA-associated sm-like protein lsm2, putative, anticorps LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog, anticorps smx5, anticorps LSM2, anticorps PFE1020w, anticorps CNC01770, anticorps EHI_068580, anticorps PCHAS_123570, anticorps BBOV_II002620, anticorps BBOV_II002860, anticorps EBI_26471, anticorps Bm1_23515, anticorps PKH_101210, anticorps CGB_C2600W, anticorps lsm2, anticorps lsm2.S, anticorps Lsm2, anticorps smx5

Sujet: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Poids moléculaire: 10 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization