KCNAB3 anticorps (N-Term)
-
- Antigène Voir toutes KCNAB3 Anticorps
- KCNAB3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNAB3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- KCNAB3 antibody was raised against the N terminal of KCNAB3
- Purification
- Purified
- Immunogène
- KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV
- Top Product
- Discover our top product KCNAB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.65 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNAB3 Blocking Peptide, catalog no. 33R-8079, is also available for use as a blocking control in assays to test for specificity of this KCNAB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNAB3 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 3 (KCNAB3))
- Autre désignation
- KCNAB3 (KCNAB3 Produits)
- Synonymes
- anticorps KCNAB3, anticorps AKR6A9, anticorps KCNA3.1B, anticorps KCNA3B, anticorps KV-BETA-3, anticorps C330022D06Rik, anticorps Kcnab4, anticorps mKv(beta)4, anticorps akr6a9, anticorps kcna3.1b, anticorps kcna3b, anticorps kcnb4-A, anticorps kv-beta-3, anticorps kvb-b, anticorps kvb4, anticorps xKvbeta4, anticorps potassium voltage-gated channel subfamily A regulatory beta subunit 3, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 3, anticorps potassium channel, voltage gated subfamily A regulatory beta subunit 3 L homeolog, anticorps KCNAB3, anticorps Kcnab3, anticorps kcnab3.L
- Sujet
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).
- Poids moléculaire
- 44 kDa (MW of target protein)
-