KCNAB2 anticorps (Middle Region)
-
- Antigène Voir toutes KCNAB2 Anticorps
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
-
Épitope
- Middle Region
-
Reactivité
- Rat, Humain, Souris, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNAB2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- KCNAB2 antibody was raised against the middle region of KCNAB2
- Purification
- Purified
- Immunogène
- KCNAB2 antibody was raised using the middle region of KCNAB2 corresponding to a region with amino acids WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
- Top Product
- Discover our top product KCNAB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KCNAB2 Blocking Peptide, catalog no. 33R-9950, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))
- Autre désignation
- KCNAB2 (KCNAB2 Produits)
- Synonymes
- anticorps kcnab2, anticorps KCNAB2, anticorps DKFZp459E056, anticorps akr6a5, anticorps kcna2b, anticorps kvb-a, anticorps kvb2, anticorps kvbeta2, anticorps kvbeta2.1, anticorps kvbeta2.2, anticorps AKR6A5, anticorps HKvbeta2, anticorps HKvbeta2.1, anticorps HKvbeta2.2, anticorps KCNA2B, anticorps KV-BETA-2, anticorps Kvbeta2.1, anticorps F5, anticorps I2rf5, anticorps Kcnb3, anticorps kv-beta-2, anticorps potassium channel, voltage gated subfamily A regulatory beta subunit 1, anticorps potassium voltage-gated channel subfamily A regulatory beta subunit 2, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 2 a, anticorps potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog, anticorps voltage-gated potassium channel subunit beta-2, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 2, anticorps kcnab1, anticorps KCNAB2, anticorps kcnab2a, anticorps kcnab2.L, anticorps LOC397248, anticorps Kcnab2
- Sujet
- This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.
- Poids moléculaire
- 40 kDa (MW of target protein)
-