KCNA10 anticorps (Middle Region)

N° du produit ABIN630070

Détail du produit anti-KCNA10 anticorps

Antigène: KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNA10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KCNA10 antibody was raised against the middle region of KCNA10

Purification: Purified

Immunogène: KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNA10 Blocking Peptide, catalog no. 33R-6970, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNA10

Antigène: KCNA10 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10))

Autre désignation: KCNA10 (KCNA10 Produits)

Synonymes: anticorps cKv1.2, anticorps Kcn1, anticorps Kv1.8, anticorps Gm1962, anticorps Kcna8, anticorps potassium voltage-gated channel subfamily A member 10, anticorps potassium voltage-gated channel, shaker-related subfamily, member 10, anticorps KCNA10, anticorps Kcna10

Sujet: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Poids moléculaire: 56 kDa (MW of target protein)