KCNAB2 anticorps (C-Term)

N° du produit ABIN630079

Détail du produit anti-KCNAB2 anticorps

Antigène: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Épitope: C-Term

Reactivité: Rat, Humain, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNAB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNAB2 antibody was raised against the C terminal of KCNAB2

Purification: Purified

Immunogène: KCNAB2 antibody was raised using the C terminal of KCNAB2 corresponding to a region with amino acids KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNAB2 Blocking Peptide, catalog no. 33R-4735, is also available for use as a blocking control in assays to test for specificity of this KCNAB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNAB2

Antigène: KCNAB2 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 2 (KCNAB2))

Autre désignation: KCNAB2 (KCNAB2 Produits)

Synonymes: anticorps kcnab2, anticorps KCNAB2, anticorps DKFZp459E056, anticorps akr6a5, anticorps kcna2b, anticorps kvb-a, anticorps kvb2, anticorps kvbeta2, anticorps kvbeta2.1, anticorps kvbeta2.2, anticorps AKR6A5, anticorps HKvbeta2, anticorps HKvbeta2.1, anticorps HKvbeta2.2, anticorps KCNA2B, anticorps KV-BETA-2, anticorps Kvbeta2.1, anticorps F5, anticorps I2rf5, anticorps Kcnb3, anticorps kv-beta-2, anticorps potassium channel, voltage gated subfamily A regulatory beta subunit 1, anticorps potassium voltage-gated channel subfamily A regulatory beta subunit 2, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 2 a, anticorps potassium channel, voltage gated subfamily A regulatory beta subunit 2 L homeolog, anticorps voltage-gated potassium channel subunit beta-2, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 2, anticorps kcnab1, anticorps KCNAB2, anticorps kcnab2a, anticorps kcnab2.L, anticorps LOC397248, anticorps Kcnab2

Sujet: This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

Poids moléculaire: 39 kDa (MW of target protein)