P2RX2 anticorps (Middle Region)

N° du produit ABIN630093

Détail du produit anti-P2RX2 anticorps

Antigène: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P2RX2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: P2 RX2 antibody was raised against the middle region of P2 X2

Purification: Purified

Immunogène: P2 RX2 antibody was raised using the middle region of P2 X2 corresponding to a region with amino acids LIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEK

Information d'application

Indications d'application: WB: 0.6 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P2RX2 Blocking Peptide, catalog no. 33R-5050, is also available for use as a blocking control in assays to test for specificity of this P2RX2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P2RX2

Antigène: P2RX2 (Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2))

Autre désignation: P2RX2 (P2RX2 Produits)

Sujet: P2RX2 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development, Positive Regulation of Endopeptidase Activity