KCNQ2 anticorps (Middle Region)

N° du produit ABIN630098

Détail du produit anti-KCNQ2 anticorps

Antigène: KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))

Épitope: Middle Region

Reactivité: Rat, Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNQ2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KCNQ2 antibody was raised against the middle region of KCNQ2

Purification: Purified

Immunogène: KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNQ2 Blocking Peptide, catalog no. 33R-3461, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNQ2

Antigène: KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))

Autre désignation: KCNQ2 (KCNQ2 Produits)

Synonymes: anticorps BFNC, anticorps BFNS1, anticorps EBN, anticorps EBN1, anticorps EIEE7, anticorps ENB1, anticorps HNSPC, anticorps KCNA11, anticorps KV7.2, anticorps KVEBN1, anticorps KQT2, anticorps Nmf134, anticorps mKQT2.3, anticorps mKQT2.4, anticorps zgc:171872, anticorps potassium voltage-gated channel subfamily Q member 2, anticorps potassium voltage-gated channel, subfamily Q, member 2, anticorps potassium voltage-gated channel subfamily KQT member 2, anticorps potassium voltage-gated channel, KQT-like subfamily, member 2a, anticorps KCNQ2, anticorps Kcnq2, anticorps LOC100537363, anticorps kcnq2a

Sujet: The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).

Poids moléculaire: 43 kDa (MW of target protein)