KCND3 anticorps (Middle Region)

N° du produit ABIN630099

Détail du produit anti-KCND3 anticorps

Antigène: KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCND3 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCND3 antibody was raised against the middle region of KCND3

Purification: Purified

Immunogène: KCND3 antibody was raised using the middle region of KCND3 corresponding to a region with amino acids KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCND3 Blocking Peptide, catalog no. 33R-4258, is also available for use as a blocking control in assays to test for specificity of this KCND3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCND3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCND3

Antigène: KCND3 (Potassium Voltage-Gated Channel, Shal-Related Subfamily, Member 3 (KCND3))

Autre désignation: KCND3 (KCND3 Produits)

Synonymes: anticorps KCND3, anticorps zgc:55306, anticorps wu:fi06g01, anticorps kv4.3, anticorps K(v)4.3, anticorps AW045978, anticorps Kncd3, anticorps Kv4.3, anticorps KCND3L, anticorps KCND3S, anticorps KSHIVB, anticorps KV4.3, anticorps kcnd3-A, anticorps xKv4.3, anticorps potassium voltage-gated channel subfamily D member 3, anticorps potassium voltage-gated channel, Shal-related subfamily, member 3, anticorps potassium channel, voltage gated Shal related subfamily D, member 3, anticorps potassium voltage-gated channel, Shal-related family, member 3, anticorps potassium channel, voltage gated Shal related subfamily D, member 3 L homeolog, anticorps KCND3, anticorps kcnd3, anticorps Kcnd3, anticorps kcnd3.L

Sujet: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.

Poids moléculaire: 70 kDa (MW of target protein)