CACNG4 anticorps (N-Term)
-
- Antigène Voir toutes CACNG4 Anticorps
- CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACNG4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACNG4 antibody was raised against the N terminal of CACNG4
- Purification
- Purified
- Immunogène
- CACNG4 antibody was raised using the N terminal of CACNG4 corresponding to a region with amino acids GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL
- Top Product
- Discover our top product CACNG4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.31 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACNG4 Blocking Peptide, catalog no. 33R-3480, is also available for use as a blocking control in assays to test for specificity of this CACNG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACNG4 (Calcium Channel, Voltage-Dependent, gamma Subunit 4 (CACNG4))
- Autre désignation
- CACNG4 (CACNG4 Produits)
- Synonymes
- anticorps CACNG4, anticorps AI413107, anticorps AW491861, anticorps calcium voltage-gated channel auxiliary subunit gamma 4, anticorps calcium channel, voltage-dependent, gamma subunit 4, anticorps CACNG4, anticorps Cacng4
- Sujet
- L-type calcium channels are composed of five subunits. CACNG4 represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is a member of the neuronal calcium channel gamma subunit geneubfamily of the PMP-22/EMP/MP20 family.L-type calcium channels are composed of five subunits.
- Poids moléculaire
- 36 kDa (MW of target protein)
-