P2RX1 anticorps (Middle Region)

N° du produit ABIN630119

Détail du produit anti-P2RX1 anticorps

Antigène: P2RX1 (Purinergic Receptor P2X, Ligand Gated Ion Channel 1 (P2RX1))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P2RX1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: P2 RX1 antibody was raised against the middle region of P2 X1

Purification: Purified

Immunogène: P2 RX1 antibody was raised using the middle region of P2 X1 corresponding to a region with amino acids VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P2RX1 Blocking Peptide, catalog no. 33R-9880, is also available for use as a blocking control in assays to test for specificity of this P2RX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P2RX1

Antigène: P2RX1 (Purinergic Receptor P2X, Ligand Gated Ion Channel 1 (P2RX1))

Autre désignation: P2RX1 (P2RX1 Produits)

Sujet: P2RX1 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel with relatively high calcium permeability. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle, being responsible, for example, for sympathetic vasoconstriction in small arteries, arterioles and vas deferens. Mouse studies suggest that this receptor is essential for normal male reproductive function. It is possible that the development of selective antagonists for this receptor may provide an effective non-hormonal male contraceptive pill.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity