TR4 anticorps (C-Term)

N° du produit ABIN630120

Détail du produit anti-TR4 anticorps

Antigène: TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TR4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: NR2 C2 antibody was raised against the C terminal of NR2 2

Purification: Purified

Immunogène: NR2 C2 antibody was raised using the C terminal of NR2 2 corresponding to a region with amino acids AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR2C2 Blocking Peptide, catalog no. 33R-1445, is also available for use as a blocking control in assays to test for specificity of this NR2C2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TR4

Antigène: TR4 (NR2C2) (Nuclear Receptor Subfamily 2, Group C, Member 2 (NR2C2))

Autre désignation: NR2C2 (NR2C2 Produits)

Synonymes: anticorps TAK1, anticorps TR2R1, anticorps TR4, anticorps hTAK1, anticorps Tr4, anticorps gb:dq017625, anticorps im:6911408, anticorps mKIAA4145, anticorps nuclear receptor subfamily 2 group C member 2, anticorps nuclear receptor subfamily 2, group C, member 2, anticorps NR2C2, anticorps Nr2c2, anticorps nr2c2

Sujet: Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes.Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: TCR Signaling, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Tube Formation, Toll-Like Receptors Cascades