WNT9B anticorps (C-Term)
-
- Antigène Voir toutes WNT9B Anticorps
- WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WNT9B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- WNT9 B antibody was raised against the C terminal of WNT9
- Purification
- Purified
- Immunogène
- WNT9 B antibody was raised using the C terminal of WNT9 corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD
- Top Product
- Discover our top product WNT9B Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WNT9B Blocking Peptide, catalog no. 33R-3045, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))
- Autre désignation
- WNT9B (WNT9B Produits)
- Synonymes
- anticorps WNT14B, anticorps WNT15, anticorps WNT9B, anticorps wnt-9b, anticorps Wnt14b, anticorps Wnt15, anticorps clf, anticorps clf1, anticorps wnt-14b, anticorps wnt-15, anticorps Wnt family member 9B, anticorps wingless-type MMTV integration site family member 9B L homeolog, anticorps protein Wnt-9b, anticorps wingless-type MMTV integration site family, member 9B, anticorps WNT9B, anticorps wnt9b.2.L, anticorps Wnt9b, anticorps LOC468296, anticorps wnt9b
- Sujet
- WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Signalisation WNT, Tube Formation
-