DVL1 anticorps
-
- Antigène Voir toutes DVL1 Anticorps
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DVL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK
- Top Product
- Discover our top product DVL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DVL1 Blocking Peptide, catalog no. 33R-5088, is also available for use as a blocking control in assays to test for specificity of this DVL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))
- Autre désignation
- DVL1 (DVL1 Produits)
- Synonymes
- anticorps DVL, anticorps DVL1L1, anticorps DVL1P1, anticorps Dvl, anticorps mKIAA4029, anticorps dvl-1, anticorps DSH, anticorps DVL-1, anticorps dvl1, anticorps dvl2l, anticorps Xdsh, anticorps dsh1, anticorps dishevelled segment polarity protein 1, anticorps dishevelled, dsh homolog 1 (Drosophila), anticorps microRNA 6808, anticorps dishevelled segment polarity protein 1b, anticorps dishevelled segment polarity protein 1 L homeolog, anticorps DVL1, anticorps Dvl1, anticorps MIR6808, anticorps dvl1b, anticorps dvl1.L
- Sujet
- DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
- Poids moléculaire
- 38 kDa (MW of target protein)
- Pathways
- Signalisation WNT, Synaptic Membrane, Skeletal Muscle Fiber Development
-