BLK anticorps (Middle Region)

N° du produit ABIN630217

Détail du produit anti-BLK anticorps

Antigène: BLK (B Lymphoid Tyrosine Kinase (BLK))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BLK est non-conjugé

Application: Western Blotting (WB)

Specificité: BLK antibody was raised against the middle region of BLK

Purification: Purified

Immunogène: BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BLK Blocking Peptide, catalog no. 33R-1621, is also available for use as a blocking control in assays to test for specificity of this BLK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BLK

Antigène: BLK (B Lymphoid Tyrosine Kinase (BLK))

Autre désignation: BLK (BLK Produits)

Synonymes: anticorps bltk, anticorps si:dkey-33i22.2, anticorps zgc:136231, anticorps MODY11, anticorps BLK proto-oncogene, Src family tyrosine kinase, anticorps B lymphoid kinase, anticorps blk, anticorps BLK, anticorps Blk

Sujet: BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling