SLC22A1 anticorps
-
- Antigène Voir toutes SLC22A1 Anticorps
- SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SLC22 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP
- Top Product
- Discover our top product SLC22A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A1 Blocking Peptide, catalog no. 33R-3892, is also available for use as a blocking control in assays to test for specificity of this SLC22A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))
- Autre désignation
- SLC22A1 (SLC22A1 Produits)
- Synonymes
- anticorps SLC22A1, anticorps OCT1, anticorps HOCT1, anticorps oct1_cds, anticorps Lx1, anticorps Oct1, anticorps Orct, anticorps Orct1, anticorps Roct1, anticorps SLC22A2, anticorps solute carrier family 22 member 1, anticorps solute carrier family 22 (organic cation transporter), member 1, anticorps solute carrier family 22 member 2-like, anticorps SLC22A1, anticorps Slc22a1, anticorps LOC421584
- Sujet
- Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Hormone Transport
-