SLC25A16 anticorps (N-Term)
-
- Antigène Voir toutes SLC25A16 Anticorps
- SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC25 A16 antibody was raised against the N terminal of SLC25 16
- Purification
- Purified
- Immunogène
- SLC25 A16 antibody was raised using the N terminal of SLC25 16 corresponding to a region with amino acids KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM
- Top Product
- Discover our top product SLC25A16 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A16 Blocking Peptide, catalog no. 33R-4697, is also available for use as a blocking control in assays to test for specificity of this SLC25A16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))
- Autre désignation
- SLC25A16 (SLC25A16 Produits)
- Synonymes
- anticorps gda, anticorps gdc, anticorps ml7, anticorps hml7, anticorps hgt.1, anticorps d10s105e, anticorps 3110021G18Rik, anticorps GDA, anticorps GDC, anticorps HGT.1, anticorps ML7, anticorps D10S105E, anticorps hML7, anticorps wu:fc33c08, anticorps zgc:56187, anticorps zgc:77742, anticorps solute carrier family 25 member 16, anticorps solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16, anticorps solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16, anticorps SLC25A16, anticorps slc25a16, anticorps Slc25a16
- Sujet
- SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.
- Poids moléculaire
- 36 kDa (MW of target protein)
-