SLC7A8 anticorps

N° du produit ABIN630365

Détail du produit anti-SLC7A8 anticorps

Antigène: SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC7A8 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: SLC7 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC7A8 Blocking Peptide, catalog no. 33R-7317, is also available for use as a blocking control in assays to test for specificity of this SLC7A8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC7A8

Antigène: SLC7A8 (Solute Carrier Family 7 (Amino Acid Transporter, L-Type), Member 8 (SLC7A8))

Autre désignation: SLC7A8 (SLC7A8 Produits)

Synonymes: anticorps LAT2, anticorps LPI-PC1, anticorps Lat2, anticorps Lat4, anticorps XAA2, anticorps lat2, anticorps lpi-pc1, anticorps 4F2LC-5, anticorps AA408822, anticorps si:ch211-14a17.3, anticorps si:zc14a17.3, anticorps slc7a8, anticorps solute carrier family 7 member 8, anticorps solute carrier family 7 member 8 L homeolog, anticorps solute carrier family 7 (amino acid transporter, L-type), member 8, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 8, anticorps solute carrier family 7 (amino acid transporter light chain, L system), member 8b, anticorps SLC7A8, anticorps Slc7a8, anticorps slc7a8.L, anticorps slc7a8, anticorps slc7a8b

Sujet: SLC7A8 is sodium-independent, high-affinity transport of large neutral amino acids. It has higher affinity for L-phenylalanine than LAT1 but lower affinity for glutamine and serine. L-alanine is transported at physiological concentrations. SLC7A8 also plays a role in basolateral (re)absorption of neutral amino acids.

Poids moléculaire: 37 kDa (MW of target protein)