UNC93B1 anticorps
-
- Antigène Voir toutes UNC93B1 Anticorps
- UNC93B1 (Unc-93 Homolog B1 (UNC93B1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UNC93B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
- Top Product
- Discover our top product UNC93B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UNC93B1 Blocking Peptide, catalog no. 33R-5095, is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UNC93B1 (Unc-93 Homolog B1 (UNC93B1))
- Autre désignation
- UNC93B1 (UNC93B1 Produits)
- Synonymes
- anticorps UNC93, anticorps IIAE1, anticorps UNC93B, anticorps Unc-93B1, anticorps Unc93b, anticorps unc-93 homolog B1, TLR signaling regulator, anticorps unc-93 homolog B1 (C. elegans), anticorps UNC93B1, anticorps Unc93b1
- Sujet
- UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades
-