SLC22A16 anticorps
-
- Antigène Voir toutes SLC22A16 Anticorps
- SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))
- Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC22A16 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SLC22 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDR
- Top Product
- Discover our top product SLC22A16 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC22A16 Blocking Peptide, catalog no. 33R-1816, is also available for use as a blocking control in assays to test for specificity of this SLC22A16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC22A16 (Solute Carrier Family 22 (Organic Cation Transporter), Member 16 (SLC22A16))
- Autre désignation
- SLC22A16 (SLC22A16 Produits)
- Sujet
- Organic ion transporters, such as SLC22A16, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).
- Poids moléculaire
- 63 kDa (MW of target protein)
-