PTPN2 anticorps (N-Term)
-
- Antigène Voir toutes PTPN2 Anticorps
- PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTPN2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PTPN2 antibody was raised against the N terminal of PTPN2
- Purification
- Purified
- Immunogène
- PTPN2 antibody was raised using the N terminal of PTPN2 corresponding to a region with amino acids LEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYINAS
- Top Product
- Discover our top product PTPN2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTPN2 Blocking Peptide, catalog no. 33R-4905, is also available for use as a blocking control in assays to test for specificity of this PTPN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTPN2 (Protein tyrosine Phosphatase, Non-Receptor Type 2 (PTPN2))
- Autre désignation
- PTPN2 (PTPN2 Produits)
- Synonymes
- anticorps PTN2, anticorps PTPT, anticorps TC-PTP, anticorps TCELLPTP, anticorps TCPTP, anticorps AI325124, anticorps Ptpt, anticorps PTP-1B, anticorps cb806, anticorps ptpn2, anticorps ptpn2l, anticorps wu:fc10h07, anticorps zgc:55339, anticorps zgc:76973, anticorps hm:zeh1546, anticorps zgc:63623, anticorps ptn2, anticorps ptpt, anticorps tc-ptp, anticorps tcellptp, anticorps tcptp, anticorps protein tyrosine phosphatase, non-receptor type 2, anticorps protein tyrosine phosphatase, non-receptor type 2 S homeolog, anticorps protein tyrosine phosphatase, non-receptor type 2, b, anticorps protein tyrosine phosphatase, non-receptor type 2, a, anticorps protein tyrosine phosphatase, non-receptor type 2 L homeolog, anticorps PTPN2, anticorps Ptpn2, anticorps ptpn2.S, anticorps ptpn2b, anticorps ptpn2a, anticorps ptpn2.L
- Sujet
- PTPN2 is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling
-