PPIB anticorps

N° du produit ABIN630436

Détail du produit anti-PPIB anticorps

Antigène: PPIB (Cyclophilin B (PPIB))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIB Blocking Peptide, catalog no. 33R-2937, is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIB

Antigène: PPIB (Cyclophilin B (PPIB))

Autre désignation: PPIB (PPIB Produits)

Synonymes: anticorps cypb, anticorps scylp, anticorps cyp-s1, anticorps PPIB, anticorps Ppib, anticorps ACYPI004891, anticorps AA408962, anticorps AA553318, anticorps AI844835, anticorps Cphn-2, anticorps Cphn2, anticorps CyP-20b, anticorps CypB, anticorps Scylp, anticorps CYP-S1, anticorps CYPB, anticorps OI9, anticorps SCYLP, anticorps cb87, anticorps sb:cb87, anticorps wu:fa97f08, anticorps zgc:73214, anticorps zgc:86796, anticorps peptidylprolyl isomerase B, anticorps peptidylprolyl isomerase B (cyclophilin B), anticorps peptidylprolyl isomerase B L homeolog, anticorps ppib, anticorps PPIB, anticorps Ppib, anticorps CC1G_03223, anticorps ppib.L

Sujet: PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Poids moléculaire: 24 kDa (MW of target protein)