CYP3A7 anticorps (Middle Region)

N° du produit ABIN630440

Détail du produit anti-CYP3A7 anticorps

Antigène: CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP3A7 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP3 A7 antibody was raised against the middle region of CYP3 7

Purification: Purified

Immunogène: CYP3 A7 antibody was raised using the middle region of CYP3 7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP3A7 Blocking Peptide, catalog no. 33R-4668, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP3A7

Antigène: CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))

Autre désignation: CYP3A7 (CYP3A7 Produits)

Synonymes: anticorps CP37, anticorps CYPIIIA7, anticorps P450-HFLA, anticorps cytochrome P450, family 3, subfamily A, polypeptide 7, anticorps cytochrome P450 family 3 subfamily A member 7, anticorps CYP3A7

Sujet: CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis