CYP2A13 anticorps (C-Term)

N° du produit ABIN630443

Détail du produit anti-CYP2A13 anticorps

Antigène: CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CYP2A13 est non-conjugé

Application: Western Blotting (WB)

Specificité: CYP2 A13 antibody was raised against the C terminal of CYP2 13

Purification: Purified

Immunogène: CYP2 A13 antibody was raised using the C terminal of CYP2 13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYP2A13 Blocking Peptide, catalog no. 33R-2112, is also available for use as a blocking control in assays to test for specificity of this CYP2A13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CYP2A13

Antigène: CYP2A13 (Cytochrome P450, Family 2, Subfamily A, Polypeptide 13 (CYP2A13))

Autre désignation: CYP2A13 (CYP2A13 Produits)

Synonymes: anticorps CPAD, anticorps CYP2A, anticorps CYPIIA13, anticorps MGC86391, anticorps MGC88881, anticorps CYP2A13, anticorps CYP2A6, anticorps cytochrome P450 family 2 subfamily A member 13, anticorps cytochrome P450, family 2, subfamily A, polypeptide 13, anticorps cytochrome P450 family 2 subfamily A member 13 L homeolog, anticorps cytochrome P450 family 2 subfamily A polypeptide 13, anticorps cytochrome P450 2A13, anticorps CYP2A13, anticorps cyp2a13.L, anticorps cyp2a13, anticorps LOC540707

Sujet: CYP2A13 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco.

Poids moléculaire: 54 kDa (MW of target protein)