CYP4F11 anticorps (N-Term)
-
- Antigène Voir toutes CYP4F11 Anticorps
- CYP4F11 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 11 (CYP4F11))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CYP4F11 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CYP4 F11 antibody was raised against the N terminal of CYP4 11
- Purification
- Purified
- Immunogène
- CYP4 F11 antibody was raised using the N terminal of CYP4 11 corresponding to a region with amino acids FPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLI
- Top Product
- Discover our top product CYP4F11 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CYP4F11 Blocking Peptide, catalog no. 33R-3022, is also available for use as a blocking control in assays to test for specificity of this CYP4F11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CYP4F11 (Cytochrome P450, Family 4, Subfamily F, Polypeptide 11 (CYP4F11))
- Autre désignation
- CYP4F11 (CYP4F11 Produits)
- Sujet
- CYP4F11 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The specific function of this protein has not been determined.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-