AADAC anticorps

N° du produit ABIN630448

Détail du produit anti-AADAC anticorps

Antigène: AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AADAC est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AADAC Blocking Peptide, catalog no. 33R-6939, is also available for use as a blocking control in assays to test for specificity of this AADAC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AADAC

Antigène: AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))

Autre désignation: AADAC (AADAC Produits)

Synonymes: anticorps MGC89272, anticorps AADAC, anticorps CES5A1, anticorps DAC, anticorps Aada, anticorps 5033417E09Rik, anticorps AI265437, anticorps arylacetamide deacetylase, anticorps arylacetamide deacetylase S homeolog, anticorps Arylacetamide deacetylase, anticorps arylacetamide deacetylase (esterase), anticorps LOC100056411, anticorps aadac, anticorps AADAC, anticorps aadac.S, anticorps LOC100451808, anticorps ACD3, anticorps PTRG_10278, anticorps aaad, anticorps Aadac

Sujet: Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.

Poids moléculaire: 44 kDa (MW of target protein)