WNT16 anticorps (C-Term)
-
- Antigène Voir toutes WNT16 Anticorps
- WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WNT16 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WNT16 antibody was raised against the C terminal of WNT16
- Purification
- Purified
- Immunogène
- WNT16 antibody was raised using the C terminal of WNT16 corresponding to a region with amino acids REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG
- Top Product
- Discover our top product WNT16 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WNT16 Blocking Peptide, catalog no. 33R-7873, is also available for use as a blocking control in assays to test for specificity of this WNT16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))
- Autre désignation
- WNT16 (WNT16 Produits)
- Synonymes
- anticorps zgc:77293, anticorps E130309I19Rik, anticorps Wnt family member 16, anticorps wingless-type MMTV integration site family, member 16, anticorps WNT16, anticorps wnt16, anticorps Wnt16
- Sujet
- WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.
- Poids moléculaire
- 38 kDa (MW of target protein)
- Pathways
- Signalisation WNT
-