DYRK1A anticorps

N° du produit ABIN630535

Détail du produit anti-DYRK1A anticorps

Antigène: DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DYRK1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DYRK1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DYRK1A Blocking Peptide, catalog no. 33R-4071, is also available for use as a blocking control in assays to test for specificity of this DYRK1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYRK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DYRK1A

Antigène: DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))

Autre désignation: DYRK1A (DYRK1A Produits)

Synonymes: anticorps DYRK1A, anticorps dyrk, anticorps dyrk1, anticorps hp86, anticorps mnb, anticorps mnbh, anticorps DYRK, anticorps DYRK1, anticorps HP86, anticorps MNB, anticorps MNBH, anticorps MRD7, anticorps 2310043O08Rik, anticorps D16Ertd272e, anticorps D16Ertd493e, anticorps Dyrk, anticorps ENSMUSG00000074897, anticorps Gm10783, anticorps Mnbh, anticorps Mp86, anticorps mmb, anticorps PSK47, anticorps dual specificity tyrosine phosphorylation regulated kinase 1A, anticorps dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A, anticorps dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a, anticorps dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A S homeolog, anticorps DYRK1A, anticorps dyrk1a, anticorps Dyrk1a, anticorps dyrk1a.S

Sujet: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases