MEK2 anticorps (C-Term)
-
- Antigène Voir toutes MEK2 (MAP2K2) Anticorps
- MEK2 (MAP2K2) (Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MEK2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MAP2 K2 antibody was raised against the C terminal of MAP2 2
- Purification
- Affinity purified
- Immunogène
- MAP2 K2 antibody was raised using the C terminal of MAP2 2 corresponding to a region with amino acids IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV
- Top Product
- Discover our top product MAP2K2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAP2K2 Blocking Peptide, catalog no. 33R-4027, is also available for use as a blocking control in assays to test for specificity of this MAP2K2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MEK2 (MAP2K2) (Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2))
- Autre désignation
- MAP2K2 (MAP2K2 Produits)
- Synonymes
- anticorps CFC4, anticorps MAPKK2, anticorps MEK2, anticorps MKK2, anticorps PRKMK2, anticorps AA589381, anticorps MK2, anticorps Prkmk2, anticorps ATMKK2, anticorps F27B13.50, anticorps F27B13_50, anticorps MAP KINASE KINASE 1, anticorps MAP kinase kinase 2, anticorps MK1, anticorps map2k2, anticorps wu:fa56c06, anticorps zgc:123171, anticorps zgc:172250, anticorps mitogen-activated protein kinase kinase 2, anticorps mitogen activated protein kinase kinase 2, anticorps MAP kinase kinase 2, anticorps mitogen-activated protein kinase kinase 2a, anticorps mitogen-activated protein kinase kinase 2b, anticorps MAP2K2, anticorps Map2k2, anticorps MKK2, anticorps map2k2a, anticorps map2k2b
- Sujet
- MAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Toll-Like Receptors Cascades, Signaling of Hepatocyte Growth Factor Receptor, BCR Signaling
-