SULT1C4 anticorps (Middle Region)
-
- Antigène Voir toutes SULT1C4 Anticorps
- SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SULT1C4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SULT1 C4 antibody was raised against the middle region of SULT1 4
- Purification
- Affinity purified
- Immunogène
- SULT1 C4 antibody was raised using the middle region of SULT1 4 corresponding to a region with amino acids HEHVKGWWEAKDKHRILYLFYEDMKKNPKHEIQKLAEFIGKKLDDKVLDK
- Top Product
- Discover our top product SULT1C4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SULT1C4 Blocking Peptide, catalog no. 33R-3718, is also available for use as a blocking control in assays to test for specificity of this SULT1C4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SULT1C4 (Sulfotransferase Family, Cytosolic, 1C, Member 4 (SULT1C4))
- Autre désignation
- SULT1C4 (SULT1C4 Produits)
- Synonymes
- anticorps SULT1C, anticorps SULT1C2, anticorps SULT1C4, anticorps sult1c4, anticorps sulfotransferase family 1C member 4, anticorps sulfotransferase family, cytosolic, 1C, member 4, anticorps sulfotransferase 1C4, anticorps sulfotransferase family 1C member 4 S homeolog, anticorps SULT1C4, anticorps LOC100061106, anticorps LOC100623441, anticorps sult1c4.S
- Sujet
- SULT1C4 catalyzes the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters. It may be involved in the activation of carcinogenic hyroxylamines. SULT1C4 shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.
- Poids moléculaire
- 35 kDa (MW of target protein)
-