GNAL anticorps
-
- Antigène Voir toutes GNAL Anticorps
- GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNAL est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
- Top Product
- Discover our top product GNAL Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GNAL Blocking Peptide, catalog no. 33R-1134, is also available for use as a blocking control in assays to test for specificity of this GNAL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))
- Autre désignation
- GNAL (GNAL Produits)
- Synonymes
- anticorps DYT25, anticorps zgc:103521, anticorps 2610011C15Rik, anticorps 9630020G10Rik, anticorps AI843190, anticorps Galphaolf, anticorps Gna10, anticorps Golf, anticorps Olf, anticorps RGD1305940, anticorps G protein subunit alpha L, anticorps guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type, anticorps guanine nucleotide binding protein, alpha stimulating, olfactory type, anticorps GNAL, anticorps gnal, anticorps Gnal
- Sujet
- Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.
- Poids moléculaire
- 50 kDa (MW of target protein)
-